Recombinant Human IL12B&IL12A Heterodimer Protein (Active)

CAT:
399-CSB-AP001811HU-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human IL12B&IL12A Heterodimer Protein (Active) - image 1

Recombinant Human IL12B&IL12A Heterodimer Protein (Active)

  • Product Name Alternative:

    IL-12A, CLMF p35, IL-12 subunit p35, NK cell stimulatory factor chain 1, NKSF1
  • Abbreviation:

    Recombinant Human IL12B&IL12A Heterodimer protein (Active)
  • Gene Name:

    IL12B&IL12A
  • UniProt:

    P29460 & P29459
  • Expression Region:

    23-328aa (IL12B) &23-219aa (IL12A)
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    P35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASp40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
  • Tag:

    Tag-Free
  • Type:

    Active Protein & In Stock Protein
  • Source:

    Baculovirus
  • Field of Research:

    Immunology
  • Relevance:

    Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.
  • Purity:

    >95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured in a cell proliferation assay using PHA-stimulated human T lymphoblasts. The ED50 for this effect is 0.01-0.05 ng/mL. The specific activity of rHuIL-12 is approximately 1.1 x 104 units/μg, which is calibrated against
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 µm filtered PBS, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
  • Molecular Weight:

    57.2 kDa. 75.0 kDa is the observed value of non-reducing gel, and the reducing glue is the size of p40 and p35 subunits, and 57.2 kDa is the theoretical value.
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Heterodimer