Recombinant Human High mobility group protein B1 (HMGB1), partial | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS566040-01	PARP-1 (human), (recombinant) (high purity)
MBS566040-02	PARP-1 (human), (recombinant) (high purity)
MBS566064-01	PARP-3 (human), (recombinant) (high purity)
MBS566064-02	PARP-3 (human), (recombinant) (high purity)
abx060877-1mg	Human High Density Lipoprotein
7-05322	Human High Density Lipoprotein
HS0035	Human High Grade Lymphoma
HY-E70502	Human CYP3A7,High-Reductase
HY-E70473	Human CYP2C9,High-Reductase
HY-E70465	Human CYP2A6,High-Reductase

Recombinant Human High mobility group protein B1 (HMGB1), partial

CAT:

399-CSB-MP010553HU1-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human High mobility group protein B1 (HMGB1), partial

Gene Name: HMGB1
UniProt: P09429
Expression Region: 2-67aa
Organism: Homo sapiens
Target Sequence: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKAD
Tag: N-terminal hFc-Myc-tagged
Source: Mammalian cell
Field of Research: Epigenetics and Nuclear Signaling
Assay Type: Developed Protein
Relevance: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V (D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type Cytoplasmic domain processes in developing cells .
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 36.1 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Protein Length: Partial

Complementary Product Range

Our range of products, including Recombinant Human High mobility group protein B1 (HMGB1), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-MP010553HU-02	Recombinant Human High mobility group protein B1 (HMGB1)
CSB-MP010553HU-03	Recombinant Human High mobility group protein B1 (HMGB1)
CSB-MP010553HU-01	Recombinant Human High mobility group protein B1 (HMGB1)
CSB-MP010553HU1-03	Recombinant Human High mobility group protein B1 (HMGB1), partial
CSB-EP010553HU2-02	Recombinant Human High mobility group protein B1 (HMGB1), partial
CSB-RP016044h-06	Recombinant Human High mobility group protein B1 (HMGB1), partial
CSB-EP010553HU2-03	Recombinant Human High mobility group protein B1 (HMGB1), partial
CSB-MP010553HU1-02	Recombinant Human High mobility group protein B1 (HMGB1), partial
CSB-MP010553HU1-01	Recombinant Human High mobility group protein B1 (HMGB1), partial
CSB-EP010553HU2-01	Recombinant Human High mobility group protein B1 (HMGB1), partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on