Recombinant Rat Mannose-binding protein C (Mbl2)

CAT:
399-CSB-EP013540RAe0-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Rat Mannose-binding protein C (Mbl2) - image 1

Recombinant Rat Mannose-binding protein C (Mbl2)

  • Product Name Alternative:

    (MBP-C) (Mannan-binding protein) (Ra-reactive factor polysaccharide-binding component p28A) (RaRF p28A)
  • Abbreviation:

    Recombinant Rat Mbl2 protein
  • Gene Name:

    Mbl2
  • UniProt:

    P08661
  • Expression Region:

    19-244aa
  • Organism:

    Rattus norvegicus (Rat)
  • Target Sequence:

    ETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD
  • Tag:

    N-terminal GST-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Immunology
  • Relevance:

    Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    51.5 kDa
  • References & Citations:

    "Impaired secretion of rat mannose-binding protein resulting from mutations in the collagen-like domain." Heise C.T., Nicholls J.R., Leamy C.E., Wallis R. J. Immunol. 165:1403-1409 (2000)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein