4-1BBL/TNFSF9, Human

• Description:

  4-1BBL (4-1BB ligand) is a type II membrane protein of the TNF superfamily, is expressed on antigen-presenting cells. 4-1BB with 4-1BBL can induce T-cell expansion, cytokine induction, differentiation, and upregulation of anti-apoptotic genes as well as protect T cells from activation-induced cell death (AICD) [1]. 4-1BBL stimulates T cell proliferation and induces effective anti-tumor immune responses[3]. 4-1BBL is an immunostimulant molecule that interacts with the 4-1BB high-affinity receptor during the antigen presentation, providing costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-kB, c-Jun, and p38 downstream pathways, triggering pleiotropic effects on the immune system[4]. 4-1BBL/TNFSF9 Protein, Human is a recombinant protein consisting of 184 amino acids (R71-E254) and is produced in E. coli.

• Product Name Alternative:

  4-1BBL/TNFSF9 Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Applications:

  Cancer-programmed cell death

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human.html

• Purity:

  95.83

• Smiles:

  REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

• Molecular Formula:

  8744 (Gene_ID) P41273 (R71-E254) (Accession)

• Molecular Weight:

  Approximately 19 kDa

• References & Citations:

  [1]Tan JT, et al. 4-1BB ligand, a member of the TNF family, is important for the generation of antiviral CD8 T cell responses. J Immunol. 1999 Nov 1;163 (9) :4859-68.|[2]Cannons JL, et al. 4-1BB ligand induces cell division, sustains survival, and enhances effector function of CD4 and CD8 T cells with similar efficacy. J Immunol. 2001 Aug 1;167 (3) :1313-24.|[3]Cheuk AT, et al. Role of 4-1BB:4-1BB ligand in cancer immunotherapy. Cancer Gene Ther. 2004 Mar;11 (3) :215-26.|[4]Li Y, et al. Limited Cross-Linking of 4-1BB by 4-1BB Ligand and the Agonist Monoclonal Antibody Utomilumab. Cell Rep. 2018 Oct 23;25 (4) :909-920.e4.|[5]Bitra A, et al. Crystal structure of the m4-1BB/4-1BBL complex reveals an unusual dimeric ligand that undergoes structural changes upon 4-1BB receptor binding. J Biol Chem. 2019 Feb 8;294 (6) :1831-1845.|[6]Meseck M, et al. A functional recombinant human 4-1BB ligand for immune costimulatory therapy of cancer. J Immunother. 2011 Mar;34 (2) :175-82.|[7]Martinez-Perez AG, et al. 4-1BBL as a Mediator of Cross-Talk between Innate, Adaptive, and Regulatory Immunity against Cancer. Int J Mol Sci. 2021 Jun 9;22 (12) :6210.|[8]Salih HR, et al. Soluble CD137 (4-1BB) ligand is released following leukocyte activation and is found in sera of patients with hematological malignancies. J Immunol. 2001 Oct 1;167 (7) :4059-66.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins