Products for Research Use Only
RegisterLogin

Recombinant Mouse CD160 (C-6His)

CAT: 0793-32-8996-50Size: 50 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-8996-50Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: Human Cells. MW :15.8kD. Recombinant Mouse CD160 Antigen is produced by our Mammalian expression system and the target gene encoding Gly28-Ser160 is expressed with a 6His tag at the C-terminus. CD160 antigen is a cell membrane protein which contains one Ig-likeV-type (immunoglobulin-like) domain. CD160 is a GPI-anchored lymphocyte surface receptor in which expression is mostly restricted to the highly cytotoxic CD56 (dim) CD16 (+) peripheral blood NK subset. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules. CD160 is expressed in spleen, peripheral blood, and smal lintestine. Expression of CD160 is restricted to functional NK and T cytotoxic lymphocytes. CD160 acts as a co-activator receptor for CD3-induced proliferation of CD4+ CD160+ T cells isolated from inflammatory skin lesions. Activated NK lymphocytes release a soluble form of CD160 that functionally impairs the MHC-I-specific cytotoxic CD8 (+) T lymphocyte responsiveness.
Gene Name
Cd160
UniProt
Q8VC80
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETSLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLSHHHHHH

UniProtKB · Q8VC80

CD160 antigen

Q8VC80_MOUSE · Mus musculus

View on UniProt ↗
Primary accession
Q8VC80
Review status
UniProtKB unreviewed (TrEMBL)
Gene
Cd160
Protein existence
2: Evidence at transcript level
Organism
Mus musculus (Mouse)
Taxonomy ID
10090
Alternative names
—
EC number
—
Processing
—
Secondary accessions
—
Protein keywords

Biological process

Adaptive immunityImmunityInnate immunity

Cellular component

Cell membraneMembraneSecreted

PTM

Disulfide bondGlycoproteinGPI-anchorLipoprotein

Domain

Immunoglobulin domainSignal

Molecular function

Receptor

Related Products

CatalogName
32-9641-50Recombinant Cynomolgus CD160 (C-6His)
32-9641-500Recombinant Cynomolgus CD160 (C-6His)
32-7765-10Recombinant Human CD160/BY55 (C-6His)
32-7765-50Recombinant Human CD160/BY55 (C-6His)
32-8907-50Recombinant Mouse SLAM/CD150 (C-6His)
32-8907-10Recombinant Mouse SLAM/CD150 (C-6His)
32-8715-10Recombinant Mouse DDR2/CD167/TKT (C-6His)
32-8715-50Recombinant Mouse DDR2/CD167/TKT (C-6His)
32-11381-50Recombinant Cynomolgus CD16a (C-6His)
32-11381-10Recombinant Cynomolgus CD16a (C-6His)

Alternative Products

CatalogName
CU16-50ugRecombinant Mouse CD160 (C-6His)
PHH0298-01Recombinant Human CD160 (C-6His)
CW17-500ugRecombinant Cynomolgus CD160 (C-6His)
CA35-50ugRecombinant Human CD160/BY55 (C-6His)
PHV2027-01Recombinant Rhesus Macaque CD160 (C-6His)
MBS2552464-01Recombinant Human CD160/BY55 Protein (C-6His)
AP2C782-01Recombinant Mouse CD160 Antigen (CD160), C-His
MBS1145895-01Recombinant Mouse CD160 antigen (Cd160)
R9019mMouse Cd160 / CD160 antigen Recombinant Protein
Pr23048-01Recombinant Mouse CD160

Popular Products