Products for Research Use Only
RegisterLogin

Recombinant Mouse Interleukin-23/IL-23

CAT: 0793-32-8916-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-8916-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: Human Cells. MW :19.7&35.8kD. Recombinant Mouse Interleukin-23 is produced by our Mammalian expression system and the target gene encoding Val22-Ala196&Met23-Ser335 is expressed. Interleukin 23 (IL-23) is a heterodimeric cytokine composed of two disulfide-linked subunits, a p19 subunit that is unique to IL-23, and a p40 subunit that is shared with IL-12. The p19 subunit has homology to the p35 subunit of IL-12, as well as to other single chain cytokines such as IL-6 and IL-11. The p40 subunit is homologous to the extracellular domains of the hematopoietic cytokine receptors. Although p19 is expressed by activated macrophages, dendritic cells, T cells, and endothelial cells, only activated macrophages and dendritic cells express p40 concurrently to produce IL-23. IL-23 has biological activities that are similar to, but distinct from IL-12. Both IL-12 and IL-23 induce proliferation and IFN-gamma production by human T cells. While IL-12 acts on both naive and memory human T cells, the effects of IL-23 is restricted to memory T cells.
Gene Name
Il23a
Gene ID
83430
UniProt
Q9EQ14
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Related Products

CatalogName
90-2258-1 X 96Mouse IL-23 (Interleukin 23) Pre-Coated ELISA Kit
32-11087-50Recombinant Mouse IL-23
32-11087-10Recombinant Mouse IL-23
90-2243-1 x 96Human IL-23 (Interleukin-23) Pre-Coated ELISA Kit
32-1499-10IL 23 His Recombinant Protein
32-8652-10Recombinant Mouse IL-23 Receptor/IL-23R (C-Fc)
32-8652-50Recombinant Mouse IL-23 Receptor/IL-23R (C-Fc)
32-11383-50Recombinant Human IL-23 (C-Fc)
32-11347-50Recombinant Human IL-23 (C-6His)
32-11383-10Recombinant Human IL-23 (C-Fc)

Alternative Products

CatalogName
CS31-1mgRecombinant Mouse Interleukin-23/IL-23
PKSM041087-01Recombinant Mouse Interleukin-23/IL-23 Protein
CI18-10ugRecombinant Mouse Interleukin-23/IL-23 (C-6His)
AP2C928-01Recombinant Mouse Interleukin-23 Subunit Alpha (IL-23)
AP2C908-01Recombinant Mouse Interleukin-23 Subunit Alpha (IL-23), C-His
MBS7622168-01Recombinant Mouse IL-23
MBS7115063-01Recombinant Human Interleukin-23 (IL-23)
P516431Interleukin-23; IL-23 Protein (Mouse)
PT_73373-01Interleukin-23 Human Recombinant (IL 23 Human)
JOT-EK0519Mo-01Mouse Interleukin 23,IL-23 ELISA KIT

Popular Products