Products for Research Use Only
RegisterLogin

Recombinant Human Interleukin-28B/IL-28B/IFN-lambda 3

CAT: 0793-32-8911-50Size: 50 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-8911-50Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: Human Cells. MW :19.6kD. Recombinant Human Interleukin-28B is produced by our Mammalian expression system and the target gene encoding Val22-Val196 is expressed. Interleukin-28B, also known as Cytokine Zcyto22, Interferon lambda-3, Interferon lambda-4, IFNL3, IFNL4, ZCYTO22 and IL28B, is a secreted cytokine which belongs to the IL-28/IL-29 family. IL-28 has also been shown to play a role in the adaptive immune response. IL28B has immunomodulatory activity and up-regulates MHC class I antigen expression. IL28B displays potent antiviral activity and antitumor activity. In addition, IL28B is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.
Gene Name
IFNL3
Gene ID
282617
UniProt
Q8IZI9
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Related Products

CatalogName
32-18085-50Recombinant Human IL-28B Protein
32-7575-50Recombinant Human Interferon Lambda-1/IL-29/IFN-Lambda1 (C-10His)
32-7575-10Recombinant Human Interferon Lambda-1/IL-29/IFN-Lambda1 (C-10His)
32-1508-20MIL 28B Recombinant Protein
32-8179-10Recombinant Human Interleukin-3/IL-3 (N-6His)
32-8179-50Recombinant Human Interleukin-3/IL-3 (N-6His)
32-9732-500Recombinant Human Interleukin-3/IL-3 (C-6His)
32-9732-50Recombinant Human Interleukin-3/IL-3 (C-6His)
32-8802-10Recombinant Mouse Interleukin-3/IL-3 (C-6His)
32-8802-50Recombinant Mouse Interleukin-3/IL-3 (C-6His)

Alternative Products

CatalogName
AP76397-01Recombinant Human Interleukin-28B/IL-28B/IFN-lambda 3
AP75451-01Recombinant Human Interleukin-28B/IL-28B/IFN-lambda 3 (C-6His)
ARP5890-01Recombinant Human Interleukin-28B/IL-28B/IFN-lambda 3 Protein (C-6His)
PH2020-.01Recombinant Human IL-28B/IFN-lambda 3
PT_73369-01Interleukin-28B Human Recombinant (IL 28B Human)
368997IL-28B, Recombinant, Human (Interferon lambda-3, IFN-lambda 3, IL 28B, IL28B) discontinued
NBP2-52083-0.25mgRecombinant Human IL-28B/IFN-lambda 3 Protein
RP00219-01Recombinant Human IFN-lambda 3/IL-28B Protein
5259-IL-025/CFRecombinant Human IL-28B/IFN-lambda 3 CF
PROTQ8IZI9-3-20ugHuman recombinant IL-28B (Interleukin-28B) protein, AF

Popular Products