Products for Research Use Only

Recombinant Mouse VSIG4 (C-6His)

CAT: 0793-32-8841-50Size: 50 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0793-32-8841-50Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: Human Cells. MW :19.7kD. Recombinant Mouse V-Set and Ig Domain-Containing Protein 4 is produced by our Mammalian expression system and the target gene encoding His20-Pro187 is expressed with a 6His tag at the C-terminus. V-set and immunoglobulin domain containing 4 (VSIG4) is a type I transmembrane glycoprotein that is a B7 family-related protein and an Ig superfamily member. Mouse VSIG4 is synthesized as a 280 amino acid (aa) precursor that contains a signal sequence, an IgV-type immunological domain (aa 36-115), one potential N-linked glycosylation site, and a single transmembrane domain. The IgV domain of mouse VSIG4 shares 86% and 80% aa sequence identity with the IgV domains of rat and human VSIG4, respectively. VSIG4 functions as a negative regulator of mouse as well as human T cell activation, and may be involved in the maintenance of peripheral T cell tolerance and/or unresponsiveness. VSIG4 acts as a macrophage complement receptor by binding complement fragments C3b and iC3b. VSIG4 binding to C3b inhibits complement activation through the alternative pathway, making it a potent suppressor of established inflammation.
Gene Name
Vsig4
Gene ID
278180
UniProt
F6TUL9
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLPHHHHHH

UniProtKB · F6TUL9

Protein information

F6TUL9_MOUSE · Mus musculus

View on UniProt ↗
Primary accession
F6TUL9
Review status
UniProtKB unreviewed (TrEMBL)
Gene
Vsig4
Protein existence
1: Evidence at protein level
Organism
Mus musculus (Mouse)
Taxonomy ID
10090
Alternative names
—
EC number
—
Processing
—
Secondary accessions
—
Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Domain

Immunoglobulin domainSignalTransmembraneTransmembrane helix

Cellular component

Membrane