RegisterLogin

Recombinant Human Complement Component C3a/C3a

CAT: 0793-32-8785-50Size: 50 µgDry Ice: YesHazardous: No
CAT#:0793-32-8785-50Size:50 µg
Selected
PRICE
AVAILABILITY
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
Source: E.coli. MW :9.1kD. Recombinant Human Complement Component C3a is produced by our E.coli expression system and the target gene encoding Ser672-Arg748 is expressed. Complement is defined as key part of innate immunity and as the first line of defense in the fight against invading pathogens. Complement 3 (C3) is the most abundant component of the complement cascade and the convergent point for all three major complement activation pathways: namely classical, alternative and mannose-binding lectin pathways. Complement activation leads to the formation of the C3 convertase, which cleaves C3 into the key effector molecules, C3a (anaphylatoxin) and C3b (opsonin) which then drive microbe removal. By binding to C3a receptor (C3aR), C3a exhibits potent anaphylatoxin activity, including increased vascular permeability, triggering degranulation of mast cells, inflammation, and activating leukocytes.
Gene Name
C3
Gene ID
718
UniProt
P01024
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR

Related Products

CatalogName
32-8764-50Recombinant Mouse Complement Component C3a/C3a
32-8764-10Recombinant Mouse Complement Component C3a/C3a
32-13724-10C3a Human
32-13724-50C3a Human
32-9551-500Recombinant Human Complement Component C5a/C5a
32-9551-50Recombinant Human Complement Component C5a/C5a
32-7370-50Recombinant Human Complement Component C1q Receptor/C1QR1/CD93 (C-6His)
32-7370-10Recombinant Human Complement Component C1q Receptor/C1QR1/CD93 (C-6His)
32-8329-10Recombinant Human Complement Component C8 gamma Chain/C8G (N-6His)
32-8329-50Recombinant Human Complement Component C8 gamma Chain/C8G (N-6His)

Alternative Products

CatalogName
MBS636687-01Complement C5a, Recombinant Human
MBS9421899-01Recombinant Human Complement C3
MBS1265331-01Recombinant Human Complement C3
C0012-03AComplement C5a, Recombinant, Human
MBS9420054-01Recombinant Human Complement C5
AP60485Recombinant Human Complement Component C5a
MBS145656-01Recombinant Human Complement Factor D
MBS145897-01Recombinant Human Complement Factor B
MBS556250-01Recombinant Human Complement Factor D
TMPJ-00417-01Complement C3a Protein, Human, Recombinant

Popular Products