RegisterLogin

Recombinant Human PRL

CAT: 0793-32-8677-50Size: 50 µgDry Ice: NoHazardous: No
CAT#:0793-32-8677-50Size:50 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
Source: Human Cells. MW :23.9kD. Recombinant Human Prolactin is produced by our Mammalian expression system and the target gene encoding Leu29-Cys227 is expressed with a 6His tag at the C-terminus. Prolactin (PRL) is a secreted neuroendocrine pituitary hormone that acts primarily on the mammary gland to promote lactation, but has pleiotropic effects in both males and females. Non-glycosylated prolactin is produced by the pituitary and packaged in storage granules before secretion, while glycosylated prolactin is reported to be constitutively secreted, have lower biological potency, and be removed from the circulation more quickly. Prolactin is synthesized mainly by the anterior pituitary in all mammals, where secretion is under tonic inhibition by hypothalamic dopamine. In humans, prolactin is also produced peripherally. Prolactin expression is low during early human pregnancy, but increases in late pregnancy. The prolactin receptor (PRLR) is a transmembrane type I glycoprotein that belongs to the cytokine hematopoietic receptor family. prolactin molecule is thought to bind two receptor molecules. In addition to its lactogenic activity, peripherally produced prolactin plays roles in breast and prostate cancer development, regulation of reproductive function, and immunoregulation.
Gene Name
PRL
Gene ID
5617
UniProt
P01236
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCVDHHHHHH

Related Products

CatalogName
32-1688-20Prl R Recombinant Protein
32-11363-50Recombinant Sheep PRL (C-6His)
32-11363-10Recombinant Sheep PRL (C-6His)
32-18345-100Human PRL Protein, hFc Tag
32-18345-50Human PRL Protein, hFc Tag
35-1652-50Polyclonal Antibody to PRL-3
35-1652-100Polyclonal Antibody to PRL-3
36-3040-20Anti-Prolactin (Pituitary Tumor Marker) Monoclonal Antibody (Clone: PRL/2642)
36-3041-20Anti-Prolactin (Pituitary Tumor Marker) Monoclonal Antibody (Clone: PRL/2643)
36-3042-100Anti-Prolactin (Pituitary Tumor Marker) Monoclonal Antibody (Clone: PRL/2644)

Alternative Products

CatalogName
P0015Recombinant Human AND
MBS7612987-01Recombinant Human WAS
CC014-010Recombinant Human Apoliprotein-J (Clusterin Human Recombinant)
054-85TWEAK, recombinant / TNFSF12, recombinant (Human)
PT_39973-01Beta 2 Microglobulin Human Recombinant (B2M Human Recombinant)
PT_40053-01C-Reactive Protein Human Recombinant (CRP Human Recombinant)
P10106-01Recombinant Human FSH alpha+Recombinant Human FSH beta
MBS7621442-01Recombinant Human BTN3A2
MBS962962-01Recombinant Human Calmodulin
AP60479Recombinant Human Uteroglobin

Popular Products