RegisterLogin

Recombinant Human Persephin

CAT: 0793-32-8375-10Size: 10 µgDry Ice: NoHazardous: No
CAT#:0793-32-8375-10Size:10 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
Source: E. coli. MW :10.4kD. Recombinant Human Persephin is produced by our E.coli expression system and the target gene encoding Ala61-Gly156 is expressed. Persephin is a secreted protein, belongs to the glial cell linederived neurotrophic factor (GDNF) family of the TGF- beta superfamily. It shares 38-46% amino acid (aa) identity with family members GDNF, neurturin and artemin. It is expressed at very low levels in most tissues. Mature protein contains a signal sequence, a pro-domain and a 96 aa mature sequence with several cysteines that are conserved among family members. It circulates as an unglycosylated disulfide-linked homodimer. Like other GDNF family members, Persephin acts through engagement of GRFa4, a glycosylphosphatidylinositol (GPI) -linked GDNF receptor family Persephin is reported to promote both the survival and growth of central dopaminergic and motor neurons, and kidney development. These effects are correlated with the expression patterns of GFRa4, and RET.
Gene Name
PSPN
Gene ID
5623
UniProt
O60542
Components
Lyophilized from a 0.2 μm filtered solution of 4mM HCl.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
GSALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG

Related Products

CatalogName
32-7056-50Recombinant Human Leptin
32-7056-10Recombinant Human Leptin
32-7242-50Recombinant Human Vinculin
32-8882-50Recombinant Human S100A11
32-8883-50Recombinant Human S100A16
32-9959-500Recombinant Human Peregrin
32-10006-500Recombinant Human DDX25
32-10017-500Recombinant Human Scinderin
32-10033-500Recombinant Human PMCA4
32-10073-50Recombinant Human hVPS16

Alternative Products

CatalogName
MBS567222-01Persephin (human), (recombinant)
21540095-2Human Persephin (Recombinant)
CH91-500ugRecombinant Human Persephin
rAP-2711Persephin Human Recombinant
7185-10Persephin, human recombinant
MBS1160122-01Recombinant Human Persephin (PSPN)
NBP2-35208-500ugRecombinant Human Persephin Protein

Popular Products