Products for Research Use Only
RegisterLogin

Recombinant Human EIF4E-Binding Protein 2/EIF4EBP2 (N-6His

CAT: 0793-32-8085-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-8085-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: E.coli. MW :15.1kD. Recombinant Human EIF4E-Binding Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Ile120 is expressed with a 6His tag at the N-terminus. Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) is a member of the Eukaryotic Translation Initiation Factor 4E Binding Protein Family. EIF4EBP2 regulates eIF4E activity by preventing its assembly into the eIF4F complex, mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase pathway. This regulation of is associated to cell proliferation, cell differentiation and viral infection. Phosphorylated EIF4EBP2 on serine and threonine residues in response to insulin, EGF and PDGF.
Gene Name
EIF4EBP2
Gene ID
1979
UniProt
Q13542
Components
Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0 .
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

UniProtKB · Q13542

Eukaryotic translation initiation factor 4E-binding protein 2

4EBP2_HUMAN · Homo sapiens

View on UniProt ↗
Primary accession
Q13542
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
EIF4EBP2
Protein existence
1: Evidence at protein level
Organism
Homo sapiens (Human)
Taxonomy ID
9606
Alternative names
4E-BP2, eIF4E-binding protein 2
EC number
—
Processing
—
Secondary accessions
—
Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Cellular component

CytoplasmNucleus

PTM

Phosphoprotein

Molecular function

Protein synthesis inhibitor

Biological process

Translation regulation

Related Products

CatalogName
32-7178-50Recombinant Human EIF4E-Binding Protein 1/EIF4EBP1 (N-6His)
32-7178-10Recombinant Human EIF4E-Binding Protein 1/EIF4EBP1 (N-6His)
32-10368-500Recombinant Human eIF4E-binding protein 2 (C-His)
32-10368-50Recombinant Human eIF4E-binding protein 2 (C-His)
32-8048-10Recombinant Human WW Domain-Binding Protein 2/WBP2 (N-6His)
32-8048-50Recombinant Human WW Domain-Binding Protein 2/WBP2 (N-6His)
32-8868-10Recombinant Human Retinol-Binding Protein 3 (N-6His)
32-8868-50Recombinant Human Retinol-Binding Protein 3 (N-6His)
32-3739-20EIF4EBP2 Recombinant Protein
32-9455-500Recombinant Human S100 Calcium Binding Protein A6/S100A6 (N-6His)

Alternative Products

CatalogName
AP75724-01Recombinant Human EIF4E-Binding Protein 2/EIF4EBP2 (N-6His
ARP5951-01Recombinant Human EIF4E-Binding Protein 2/EIF4EBP2 Protein (N-6His)
CD01879-01Recombinant Human EIF4EBP2 protein (N-6His)
C200-50ugRecombinant Human EIF4E-Binding Protein 1/EIF4EBP1 (N-6His)
ARP5398-01Recombinant Human EIF4E-Binding Protein 1/EIF4EBP1 Protein (N-6His)
126241EIF4EBP2 (Eukaryotic Translation Initiation Factor 4E-binding Protein 2, 4E-BP2, eIF4E-binding Protein 2)
126241-HRPEIF4EBP2 (Eukaryotic Translation Initiation Factor 4E-binding Protein 2, 4E-BP2, eIF4E-binding Protein 2) (HRP)
MBS6141696-01EIF4EBP2 (Eukaryotic Translation Initiation Factor 4E-binding Protein 2, 4E-BP2, eIF4E-binding Protein 2) (Biotin)
126241-FITCEIF4EBP2 (Eukaryotic Translation Initiation Factor 4E-binding Protein 2, 4E-BP2, eIF4E-binding Protein 2) (FITC)
MBS6136393-01EIF4EBP2 (Eukaryotic Translation Initiation Factor 4E-binding Protein 2, 4E-BP2, eIF4E-binding Protein 2) APC

Popular Products