Products for Research Use Only
RegisterLogin

Recombinant Human CDK2AP2 (C-6His)

CAT: 0793-32-7640-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-7640-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: Human Cells. MW :14.1kD. Recombinant Human CDK2AP2 is produced by our Mammalian expression system and the target gene encoding Met1-Thr126 is expressed with a 6His tag at the C-terminus. CDK2AP2, also known as DOC1R, is short for cyclin-dependent kinase 2-associated protein 2. The gene CDK2AP2 encodes this protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. It belongs to the CDK2AP family. CDK2AP1 (cyclin-dependent kinase 2-associated protein 1), corresponding to the gene doc-1 (deleted in oral cancer 1), is a tumor suppressor protein. The doc-1 gene is absent or down-regulated in hamster oral cancer cells and in many other cancer cell types. The ubiquitously expressed CDK2AP1 protein is the only known specific inhibitor of CDK2, making it an important component of cell cycle regulation during G (1) -to-S phase transition.
Gene Name
CDK2AP2
Gene ID
10263
UniProt
O75956
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNARTVDHHHHHH

Related Products

CatalogName
32-2959-20CDK2AP2 Recombinant Protein
32-7497-10Recombinant Human VEGF-C (C-6His)
32-7497-50Recombinant Human VEGF-C (C-6His)
32-9593-500Recombinant Human CDO (C-6His)
32-9534-500Recombinant Human S100A4 (C-6His)
32-9534-50Recombinant Human S100A4 (C-6His)
32-9286-500Recombinant Human CD5L (C-6His)
32-9055-500Recombinant Human COQ7 (C-6His)
32-9055-50Recombinant Human COQ7 (C-6His)
32-8964-50Recombinant Human Decorin (C-6His)

Alternative Products

CatalogName
AP75355-01Recombinant Human CDK2AP2 (C-6His)
MBS2552486-01Recombinant Human CDK2AP2 Protein (C-6His)
MBS7608960-01Recombinant Human CDK2AP2
PR00704Recombinant Human CDK2AP2 Protein, C-His
NBP2-22972Recombinant Human CDK2AP2 Protein
RP006616CDK2AP2 Recombinant Protein (Human)
TP726894CDK2AP2 Human Recombinant Protein
P523223CDK2AP2 Protein (C-His, Human)

Popular Products