Products for Research Use Only
RegisterLogin

Recombinant Human CD14 (C-6His)

CAT: 0793-32-7286-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-7286-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: Human Cells. MW :36.81kD. Recombinant Human CD14 is produced by our Mammalian expression system and the target gene encoding Thr20-Cys352 is expressed with a 6His tag at the C-terminus. CD14 is a cell surface glycoprotein that is preferentially expressed on monocytes/macrophages. CD14 is anchored to cells by linkage to glycosylphosphatidylinositol (GPI) and functions as a pattern recognition receptor that binds lipopolysaccharides (LPS) and a variety of ligands derived from different microbial sources. The binding of CD14 with LPS is catalyzed by LPS binding protein (LBP) . Toll like receptors have also been implicated in the transduction of CD14-LPS signals. Soluble CD14 can be released from the cell surface by phosphatidyinositolspecific phospholipase C and has been detected in serum and body fluids. High concentrations of soluble CD14 have been shown to inhibit LPS mediated responses. However, soluble CD14 can also potentiate LPS response in cells that do not express cell surface CD14.
Gene Name
CD14
Gene ID
929
UniProt
P08571
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH

Related Products

CatalogName
32-10315-50Recombinant Human CD14 (C-His)
32-10315-10Recombinant Human CD14 (C-His)
32-7387-10Recombinant Human EMMPRIN/Basigin/CD147 (C-6His)
32-8628-10Recombinant Human OX40/TNFRSF4/CD134 (C-6His)
32-8628-50Recombinant Human OX40/TNFRSF4/CD134 (C-6His)
32-7387-50Recombinant Human EMMPRIN/Basigin/CD147 (C-6His)
32-7497-10Recombinant Human VEGF-C (C-6His)
32-7497-50Recombinant Human VEGF-C (C-6His)
32-9593-500Recombinant Human CDO (C-6His)
32-9534-500Recombinant Human S100A4 (C-6His)

Alternative Products

CatalogName
AP75040-01Recombinant Human CD14 (C-6His)
ARP4712-01Recombinant Human CD14 Protein (C-6His)
BP241-500ugRecombinant Human CD14 (C-His)
MBS1573151-01Recombinant Human CD14, C-His
MBS1573150-01Recombinant Human CD14, C-Fc
bs-100626P-01Recombinant Human CD14 Protein, C-Fc
AP90730Recombinant Human CD14 Protein, C-His
ARO-P21129-01Human CD14 Recombinant Protein, C-Fc
E51P00044CD14 Protein, Human, Recombinant (C-hFc)

Popular Products