Recombinant Human Leptin

CAT: 0793-32-7056-10Size: 10 µgDry Ice: NoHazardous: No
CAT#:0793-32-7056-10Size:10 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
Source: E.coli. MW :16.1kD. Recombinant Human Leptin is produced by our E.coli expression system and the target gene encoding Val22-Cys167 is expressed. Leptin is a hormone secreted from white adipocytes and plays important role in the regulation of food intake and energy balance. Leptin functions via signaling pathways involving OB-R in hypothalamus. Animal models have revealed the influence of Leptin in reducing body weight and regulating blood glucose level. When mutations are introduced in obese gene, mice with impaired function of leptin are massively obese and in high risk of diabetes. Leptin deficiency reduces metablic rate. Leptin deficient mice are less active and with lower body temperature than normal animals. Human Leptin shares approximately 84% sequence identity with the mouse protein. Human Leptin consists of 167 amino acid residue including a 21 amino acid residue signal sequence and 146 amino acid residue mature protein sequence.
Gene Name
LEP
Gene ID
3952
UniProt
P41159
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Related Products

CatalogName
32-1551-1Human Leptin
32-11303-50Recombinant Mouse Leptin
32-1550-1Leptin Recombinant Protein
32-11303-10Recombinant Mouse Leptin
32-6482-200Leptin Human, N82K
32-6482-50Leptin Human, N82K
32-1567-50Leptin tA Recombinant Protein
32-1552-25Leptin His Recombinant Protein
32-1569-50Leptin qA Recombinant Protein
32-6483-20Leptin Human, N82K PEG

Alternative Products

CatalogName
PT_41389-01Leptin Human Recombinant (Leptin Human)
MBS197016-01Recombinant Human Leptin
4366-1Leptin, human recombinant
22060402-1Human Leptin (Recombinant)
sc-471283Leptin (human), (recombinant)
003-12Leptin, recombinant (Human)

Popular Products