IL 19 Mouse

CAT: 0793-32-6466-2Size: 2 µgDry Ice: NoHazardous: No
CAT#:0793-32-6466-2Size:2 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
Source: Escherichia Coli.Sterile Filtered White lyophilized (freeze-dried) powder.IL19 is a cytokine that belongs to the IL10 cytokine subfamily. IL-19 is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3) . A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described.Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.
Product Name Alternative
Interleukin-19, IL-19, Il19.
Purification
Greater than 95.0% as determined by SDS-PAGE.
Components
Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5.It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
Amino Acids
MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA.

Related Products

CatalogName
32-1487-10IL 19 Recombinant Protein
90-2241-1 x 96Human IL-19 (Interleukin-19) Pre-Coated ELISA Kit
31-3605-0.1Mouse Anti-Cytokeratin 19
31-3606-0.1Mouse Anti-Cytokeratin 19-FITC
32-6463-2IL 18 Mouse
32-6463-10IL 18 Mouse
31-3607-1.0Mouse Anti-Cytokeratin 19-HRP Conjugated
32-9885-50Recombinant Mouse IL-1RA
32-7868-50Recombinant Mouse IL-9
32-7868-10Recombinant Mouse IL-9

Alternative Products

CatalogName
117004Mouse IgG1 Mouse
RC444043Mouse Mouse MIG
117005Mouse IgG2a Mouse
117006Mouse IgG2b Mouse
MBS8538288-01TUG (Mouse) Mouse mAb
AR01002PU-NMouse IgE Mouse Protein
MBS224809-01MOUSE ANTI MOUSE CD32B
MBS135005-01Mouse monoclonal to mouse tPA
MBS8538906-01SPLUNC2 (Mouse) Mouse mAb
RA048Mouse IgM Mouse Protein

Popular Products