Products for Research Use Only
RegisterLogin

Recombinant Human E-Selectin HEK

CAT: 0793-32-4795-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-4795-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : HEK293 cells. SELE Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 543 amino acids (22-556) . SELE is fused to an 8 amino acid His-tag at C-terminus and is purified by proprietary chromatographic techniques. E-selectin which is also called Endothelial leukocyte adhesion molecule 1, ELAM1, ELAM belongs to a family of divalent cation-dependent carbohydrate-binding glycoproteins or adhesion molecules. Eselectin is expressed on the surface of endothelial cells and mediates the interaction of leukocytes and platelets with endothelial cells during an inflammatory response. E-selectin is present in single copy in the human genome and contains 14 exons spanning about 13 kb of DNA.
Product Name Alternative
E-selectin||Endothelial leukocyte adhesion molecule 1||ELAM-1||Leukocyte-endothelial cell adhesion molecule 2||LECAM2||CD62E antigen||SELE||ELAM1||ELAM||ESEL||CD62E.
Purification
Greater than 95% as determined by SDS-PAGE.
Components
SELE was lyophilized from a 0.2 mM filtered solution of PBS and 4% Mannitol, pH 7.5.
Storage Conditions
Lyophilized SELE although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SELE should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized SELE in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Amino Acids
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH.

Related Products

CatalogName
32-4794-10Recombinant Human E-Selectin
32-11258-50Recombinant Human E-Selectin//ELAM1/CD62E (C-6His)
32-11258-10Recombinant Human E-Selectin//ELAM1/CD62E (C-6His)
32-5076-50Recombinant Human Thrombin, HEK
32-9118-500Recombinant Human E-selectin/ELAM1/CD62E (C-His)
32-9118-50Recombinant Human E-selectin/ELAM1/CD62E (C-His)
32-4959-10Recombinant Human Serglycin, HEK
32-4776-10Recombinant Human Mammaglobin-A, HEK
32-4636-10Recombinant Human Renin, HEK
32-9119-25Biotinylated Recombinant Human E-selectin/ELAM1/CD62E (C-His)

Alternative Products

CatalogName
PT_40432-01E-selectin Human Recombinant (E Selectin Human)
7-05107Recombinant Human E-Selectin
22060317-1Human E-Selectin (Recombinant)
rAP-4737E-selectin Human Recombinant
MBS960715Recombinant Human E-selectin (SELE)
rAP-4735E-Selectin Human Recombinant, HEK
MBS147408-01Recombinant Human E-Selectin, Sf9
MBS145475-01Recombinant Human E-Selectin HEK
GTR19125613-01Recombinant Human E-selectin Protein
053739-01E-selectin, Recombinant, Human, His-Tag

Popular Products