Products for Research Use Only
RegisterLogin

GNLY Recombinant Protein

CAT: 0793-32-3907-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-3907-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by proprietary chromatographic techniques. GNLY is part of the SAPLIP family and is located in the cytotoxic granules of T cells, which are discharged upon antigen stimulation. GNLY is localized in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. GNLY is an antimicrobial protein that kills intracellular pathogens. GNLY is active against a wide range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.
Product Name Alternative
LAG2||Lymphokine LAG-2||TLA519||NKG5||LAG2||D2S69E||Granulysin||T-cell activation protein 519||GNLY||D2S69E.
Purification
Greater than 95.0% as determined by SDS-PAGE.
Components
The Granulysin protein was lyophilized from a concentrated (1mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized Granulysin in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH.

Related Products

CatalogName
32-4513-10Recombinant Protein L
32-3516-20CFL2 Recombinant Protein
32-3507-20CENPP Recombinant Protein
32-3506-10CENPM Recombinant Protein
32-3505-20CENPH Recombinant Protein
32-3502-20CEND1 Recombinant Protein
32-3499-20CEACAM21 Recombinant Protein
32-3494-20CDC123 Recombinant Protein
32-3486-20CD200 Recombinant Protein
32-3485-20CD100 Recombinant Protein

Alternative Products

CatalogName
RP013579GNLY Recombinant Protein (Human)
R1517hHuman GNLY / Granulysin Recombinant Protein
PH39876M5GNLY (NM_006433) Human Recombinant Protein
PROTP22749-01GNLY Granulysin Human Recombinant Protein
E51P90205GNLY protein, Human, Recombinant (His)
MBS2580264-01Recombinant Human GNLY Protein (Trx Tag)
QP12021-1mgRecombinant Human GNLY Protein, His, E.coli-1mg
QP12021-2ugRecombinant Human GNLY Protein, His, E.coli-2ug
QP12021-10ugRecombinant Human GNLY Protein, His, E.coli-10ug
ARO-P19074-01Human GNLY/Granulysin Recombinant Protein, N-GST & C-His

Popular Products