Products for Research Use Only
RegisterLogin

MIG Recombinant Protein

CAT: 0793-32-1952-20Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-1952-20Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. MIG (monokine induced by gamma-interferon) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton. The MIG is purified by proprietary chromatographic techniques. Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by gamma interferon (MIG) . CXCL9 is a T-cell chemoattractant, which is induced by IFN-. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.
Product Name Alternative
Small inducible cytokine B9||CXCL9||Gamma interferon-induced monokine||MIG||chemokine (C-X-C motif) ligand 9||CMK||Humig||SCYB9||crg-10||monokine induced by gamma-interferon.
Purification
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
Lyophilized from a 0.2μm filtered concentrated (1.0mg/mL) solution in 20mM PB, pH 7.4, 50mM NaCl.
Storage Conditions
Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL9 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized MIG in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.
Amino Acids
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT.

Related Products

CatalogName
32-1953-20MIG His Recombinant Protein
32-6611-50MIG Bovine
32-6611-100MIG Bovine
32-4015-10MIgG Recombinant Protein
32-7391-50Recombinant Human C-X-C Motif Chemokine 9/CXCL9/MIG (C-6His)
32-7391-10Recombinant Human C-X-C Motif Chemokine 9/CXCL9/MIG (C-6His)
32-4016-20MIgG His Recombinant Protein
90-2006-1 X 96Human CXCL9/MIG (C-X-C motif chemokine 9) Pre-Coated ELISA Kit
32-4513-10Recombinant Protein L
32-3516-20CFL2 Recombinant Protein

Alternative Products

CatalogName
NBP2-34964-100mgRecombinant Protein A Protein
PROTB3GGB2-100ugS. aureus Recombinant Protein A Recombinant Protein
96-361Glyco Recombinant Protein A33 Recombinant Protein
TP780003Enterokinase Recombinant Protein (Enterokinase) Recombinant Protein
TMPY-00125Recombinant Protein A
OPCD05912-50UGON Recombinant Protein
OPCD00940-200UGWAS Recombinant Protein
22060644-1Protein A (Recombinant)

Popular Products