Products for Research Use Only
RegisterLogin

RaGHBP Recombinant Protein

CAT: 0793-32-1264-20Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-1264-20Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. Growth Hormone Binding Protein Rabbit Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 248 amino acids and having a molecular mass of 48 kDa. GHBP Rabbit is purified by proprietary chromatographic techniques. GHBP is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. Other splice variants, including one encoding a soluble form of the protein (GHRtr), have been observed but have not been thoroughly characterized.
Product Name Alternative
GHR||GHBP||GH receptor||Somatotropin receptor.
Purification
Greater than 98.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.
Components
The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1mg/mL) solution with 0.0045mM NaHCO3.
Storage Conditions
Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP Rabbit should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Amino Acids
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP.

Related Products

CatalogName
32-1275-20RaGH Recombinant Protein
32-4513-10Recombinant Protein L
32-3516-20CFL2 Recombinant Protein
32-3507-20CENPP Recombinant Protein
32-3506-10CENPM Recombinant Protein
32-3505-20CENPH Recombinant Protein
32-3502-20CEND1 Recombinant Protein
32-3499-20CEACAM21 Recombinant Protein
32-3494-20CDC123 Recombinant Protein
32-3486-20CD200 Recombinant Protein

Alternative Products

CatalogName
NBP2-34964-100mgRecombinant Protein A Protein
PROTB3GGB2-100ugS. aureus Recombinant Protein A Recombinant Protein
96-361Glyco Recombinant Protein A33 Recombinant Protein
TP780003Enterokinase Recombinant Protein (Enterokinase) Recombinant Protein
TMPY-00125Recombinant Protein A
OPCD05912-50UGON Recombinant Protein
OPCD00940-200UGWAS Recombinant Protein
22060644-1Protein A (Recombinant)
cyt-593-01raGHBP

Popular Products