Products for Research Use Only
RegisterLogin

BAFF R Recombinant Protein

CAT: 0793-32-1077-50Size: 50 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-1077-50Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.The BAFF-R is purified by proprietary chromatographic techniques. B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE) . Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.
Product Name Alternative
TNFRSF13C||CD268||BAFF-R||MGC138235||B cell-activating factor receptor.
Purification
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
Lyophilized from a 0.2μm filtered concentrated (1.0mg/mL) solution in 20mM PB, pH 8.0, 500mM NaCl.
Storage Conditions
Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 μg/ml in the presence of 1.0μg/ml of human soluble BAFF.
Amino Acids
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.

Related Products

CatalogName
32-1074-20BAFF Recombinant Protein
32-17107-50Recombinant Human BAFF-R protein with C-terminal human Fc
32-17041-50Recombinant Human BAFF-R protein with C-terminal mouse Fc
32-1075-20BAFF His Recombinant Protein
32-1076-5BAFF Plant Recombinant Protein
12-9301-100Anti-BAFF-R antibody (DM127), Rabbit mAb
12-9316-100Anti-BAFF-R antibody (DM143), Rabbit mAb
32-17962-100Recombinant Mouse BAFF Protein, hFc Tag
12-9316B-10Biotinylated Anti-BAFF-R antibody (DM143) ; Rabbit mAb
12-9301B-100Biotinylated Anti-BAFF-R antibody (DM127) ; Rabbit mAb

Alternative Products

CatalogName
40-305-002mgBAFF Recombinant Protein
P1044-1BAFF, human recombinant protein
R01257-1Canine BAFF Recombinant Protein
CD02286Recombinant Human BAFF protein
40-306-01BAFF Receptor Recombinant Protein
RP0736CChicken BAFF Recombinant Protein
R01257-4Rabbit BAFF Recombinant Protein
90-237BAFF-R Recombinant Protein
RP0904E-01Equine BAFF Recombinant Protein
RP0492S-01Swine BAFF Recombinant Protein

Popular Products