Mouse recombinant BAFF (B-cell activating factor) protein, AF

CAT: 0519-PROTQ9WU72-20ugSize: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0519-PROTQ9WU72-20ugSize:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

BAFF also known as BLYS, TALL-1 and TNFSF13B, which belongs to tumor necrosis factor family. BAFF is a 31.2 kDa type II transmembrane protein containing 285 residues that predominantly produced by myeloid cells, furthermore mouse BAFF shares 72% sequence identity with human BAFF. BAFF has been demonstrated to activate the survival of B cells and the B cell response by binding to BAFFR/BR3. Additionally, BAFF also takes part in regulating B and T cell function via forming two ligands-two receptors pathway through sharing TNFRSF13B/TACI and TNFRSF17/BCMA receptors with APRIL.

Synonyms

Tumor necrosis factor (ligand) superfamily, member 13b, Tnfsf13b, BAF, BL, BLyS, D8Ertd387, D8Ertd387e, TAL, TALL-1, TALL1, THANK, TNFSF20, Tnlg7a, zTNF, zTNF4

Gene Name

TNFSF13B

UniProt

Q9WU72

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in mouse B cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 21.56 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL with polyhistidine tag at the C-terminus.

UniProtKB · Q9WU72

Tumor necrosis factor ligand superfamily member 13B

TN13B_MOUSE · Mus musculus

View on UniProt ↗

Primary accession: Q9WU72
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: Tnfsf13b
Protein existence: 1: Evidence at protein level
Organism: Mus musculus (Mouse)
Taxonomy ID: 10090
Alternative names: —
EC number: —
Processing: —
Secondary accessions: Q7TQ58

Protein keywords

Coding sequence diversity

Alternative splicing

Cellular component

Cell membraneMembraneSecreted

PTM

Cleavage on pair of basic residuesDisulfide bondGlycoprotein

Molecular function

Cytokine

Technical term

Reference proteome

Domain

Signal-anchorTransmembraneTransmembrane helix

Related Products

Catalog	Name
PROTQ9Y275-6-5ug	Human recombinant BAFF (B-cell activating factor) protein, AF
PROTQ9Y275-6-100ug	Human recombinant BAFF (B-cell activating factor) protein, AF
PROTQ9Y275-6-20ug	Human recombinant BAFF (B-cell activating factor) protein, AF
PROTQ9Y275-1	BAFF B-cell Activating Factor Human Recombinant Protein
PROTQ9Y275-2	BAFF Human, B cell Activating Factor Human Recombinant Protein, His Tag
PROTQ04999-100ug	Mouse recombinant Activin B protein, AF
PROTQ04999-20ug	Mouse recombinant Activin B protein, AF
PROTQ04999-5ug	Mouse recombinant Activin B protein, AF
PROTP09529-3-20ug	Human recombinant Activin B protein, AF
PROTP09529-3-5ug	Human recombinant Activin B protein, AF

Alternative Products

Catalog	Name
545369	B-Cell Activating Factor
GWB-D47670	BAFF (B cell activating factor)
053554	BAFF (B-Cell Activating Factor)
545370	B-Cell Activating Factor (Biotin)
169520	BAFF (B Cell-activating Factor)
GTR18084341	Anti-BAFF (B cell activating factor)
TRV-034060-01	Recombinant B-Cell Activating Factor (BAFF)
abx175539-01	B-Cell Activating Factor (BAFF) Antibody
FY-AB51816-01	Anti-B-Cell Activating Factor (BAFF)
Y080099	Anti-BAFF(B cell activating factor)