Products for Research Use Only

TLR7, Mouse (His, Myc)

CAT: 0804-HY-P79405Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P79405Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The TLR7 protein is an endosomal receptor critical in innate and adaptive immunity that recognizes uridine-containing single-stranded RNA (ssRNA) or guanosine analogs in viruses, thereby controlling the host immune response. Upon agonist binding, TLR7 dimerizes, activates the Myddosome complex and recruits downstream adapters. TLR7 Protein, Mouse (His) is the recombinant mouse-derived TLR7 protein, expressed by E. coli , with C-His labeled tag.
Product Name Alternative
TLR7 Protein, Mouse (His, Myc), Mouse, E. coli
UNSPSC
12352202
Smiles
FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS
Molecular Formula
170743 (Gene_ID) P58681 (F27-S348) (Accession)
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins