Products for Research Use Only
RegisterLogin

CLEC17A, Human (HEK293, hFc)

CAT: 0804-HY-P78965Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P78965Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CLEC17A Protein, a cell surface receptor, engages in carbohydrate-mediated intercellular communication in the germinal center. It shows affinity for glycans with alpha-linked mannose or fucose residues. As an oligomer formed through disulfide linkages, CLEC17A is crucial for complex molecular interactions, contributing to essential cellular processes within the germinal center. CLEC17A Protein, Human (CHO, hFc) is the recombinant human-derived CLEC17A protein, expressed by CHO , with N-hFc labeled tag.
Product Name Alternative
CLEC17A Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Smiles
KYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDCATMNKGGTWNDLSCYKTTYWICERKCSC
Molecular Formula
388512 (Gene_ID) Q6ZS10-1 (K194-C378) (Accession)
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P705507CD164, Human (HEK293, hFc)
HY-P704500CEACAM6 , Human (HEK293, hFc)
HY-P703904-01IGF2R, Human (HEK293, hFc)
HY-P701021-01LY6G6F, Human (HEK293, hFc)
HY-P72031-01RBP4, Human (HEK293, hFc)
HY-P75156-01GRIK2, Human (HEK293, hFc)
HY-P700621-01PCSK6, Human (HEK293, hFc)
HY-P701054-01TREML1, Human (HEK293, hFc)
HY-P72486A-01PSG1, Human (HEK293, hFc)
HY-P74588-01S100A1, Human (HEK293, hFc)

Alternative Products

CatalogName
TMPY-07162-01CLEC17A Protein, Human, Recombinant (hFc)
MBS8126012-01Recombinant Human CLEC17A Protein (ECD, hFc Tag), HPLC-verified
bs-43566P-01Recombinant human CD26 protein, hFc (HEK293)
bs-43106P-01Recombinant human Osteocalcin, C-hFc (HEK293)
bs-43116P-01Recombinant human CD9 protein, hFc (HEK293)
GTR19030863-01Recombinant human CD63 protein, hFc (HEK293)
bs-43118P-01Recombinant human CD81 protein, hFc (HEK293)
GTR19008411-01Recombinant human ACE2 protein, hFc (HEK293)
bs-47210P-01Recombinant human TIGIT Protein, C-hFc (HEK293)
bs-47048P-01Recombinant human CD24 Protein, C-hFc (HEK293)

Popular Products