Products for Research Use Only
RegisterLogin

B3GNT2, Human (HEK293, His)

CAT: 0804-HY-P76160A-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P76160A-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The B3GNT2 protein is a member of the zinc-containing alcohol dehydrogenase family and facilitates the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme is widely distributed in organisms, has zinc ions in its active site, and catalyzes substrate conversion through dehydrogenation. B3GNT2 Protein, Human (HEK293, His) is the recombinant human-derived B3GNT2 protein, expressed by HEK293 , with N-6*His labeled tag.
Product Name Alternative
B3GNT2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Purity
95
Smiles
KSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC
Molecular Formula
10678 (Gene_ID) Q9NY97-1 (K29-C397) (Accession)
Molecular Weight
Approximately 55-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P76160-01B3GNT2, Human (HEK293, Fc)
HY-P7627B3GNT1, Human (HEK293, His)
HY-P70114-01B3GAT1, Human (HEK293, His)
HY-P704043SFTPC, Human (HEK293, His)
HY-P75386A-01CD79, Human (HEK293, His)
HY-P73753NAGA, Human (HEK293, His)
HY-P76411-01IGSF11, Human (HEK293, His)
HY-P76961-01GPR133, Human (HEK293, His)
HY-P76680-01TMPRSS11D, Human (HEK293, His)
HY-P75561-01ACP5, Human (HEK293, His)

Alternative Products

CatalogName
MBS8114540-01Human B3GNT2 HEK293 Overexpression Lysate
E51P80204B3GNT2 protein, Human, Recombinant (His)
MBS206408-01B3GNT2, 29-397aa, Human, His-tagged, Baculovirus
PV003372B3GNT2 Protein Vector (Human) (pPM-C-His)
E53A01285B3GNT2, 29-397aa, Human, His-tag, Baculovirus
QP11119-5ugRecombinant Human B3GNT2 Protein, His, Insect-5ug
QP11119-50ugRecombinant Human B3GNT2 Protein, His, Insect-50ug
QP11119-1ugRecombinant Human B3GNT2 Protein, His, Insect-1ug
PV003370B3GNT2 Protein Vector (Human) (pPB-N-His)
PV003369B3GNT2 Protein Vector (Human) (pPB-C-His)

Popular Products