Products for Research Use Only
RegisterLogin

TLR4, Human (sf9, His, Solution)

CAT: 0804-HY-P73586Y-01Size: 10 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P73586Y-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.
Product Name Alternative
TLR4 Protein, Human (sf9, His, Solution), Human, Sf9 insect cells
UNSPSC
12352202
Purity
91.40
Smiles
ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK
Molecular Formula
7099 (Gene_ID) O00206-1 (E24-K631) (Accession)
Molecular Weight
Approximately 68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P73586TLR4, Human (sf9, His)
HY-P73590Y-01TLR2, Mouse (sf9, His, solution)
HY-P703943Y-01HK2, Human (sf9, His, solution)
HY-P73414A-01SLPI, Human (sf9, His, solution)
HY-P74222Y-01COX-2, Human (sf9, His, solution)
HY-P73628Y-01STAT1, Human (sf9, His-GST, solution)
HY-P75567Y-01AARS1, Mouse (sf9, His, solution)
HY-P76103-01TCPTP, Human (sf9, solution)
HY-P75897Y-01KEAP1, Human (sf9, solution)
HY-P76114Y-01TGM2/Transglutaminase 2, Human (sf9, His, solution)

Alternative Products

CatalogName
32-6490-10M CSF Human, Sf9 His
GTR18984855-01Human M CSF His (Sf9) Protein
E53A02421HDAC8, 1-377aa, Human, His tag, sf9
RP-792Recombinant (Sf9, his tag) Human RO-52/SS-A
MBS147042-01Recombinant Human Macrophage Colony Stimulating Factor, Sf9 His
SCL702-R-10Recombinant (sf9) Human Scl-70 protein (>95%, His-tag)
IKKB35-R-5Recombinant purified human IKKB-beta (Sf9; GST-His-IKK-B), active
C1QB15-R-10Recombinant (SF9) Human C1qB protein (aa: 1-253, >90% Pure, His tag)
SSA525-R-10Recombinant (sf9) Human SSA-52/Ro52 (TRIM21/RNF81) protein (>95%, His-tag ~54 kda)
FCGR2A21-R-25Recombinant (sf9) Human FcGR2a/CD32 Protein (166Arg, 1-216aa, >95%, his-tag, ~25 kda, low endotoxins), active

Popular Products