Products for Research Use Only
RegisterLogin

Staphylokinase, Staphylococcus phage (His)

CAT: 0804-HY-P71923A-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71923A-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.
Product Name Alternative
Staphylokinase Protein, Staphylococcus phage (His), Others, E. coli
UNSPSC
12352202
Purity
98.0
Smiles
SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Molecular Formula
/ (Gene_ID) P15240 (S28-K163) (Accession)
Molecular Weight
Approximately 18 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-E70230Staphylokinase, staphylococcus aureus
HY-P72780-01Staphylokinase, S. aureus
HY-P78939T4 gp32, T4 phage (His)
HY-P78938T4 ligase, T4 phage (His)
HY-P701851Gp15, Escherichia phage T7 (His, Strep)
HY-P701904Dit, Bacillus phage SPP1 (FLAG, His)
HY-P700312T4 gp32, T4 phage (His, Myc)
HY-P78940-01T4 DNA Polymerase, T4 phage (His)
HY-P701992-01λPP, Escherichia phage lambda (His, FLAG)
HY-P703434-01SrtA, Staphylococcus aureus (His)

Alternative Products

CatalogName
MBS1469007-01Recombinant Staphylococcus phage phi13 Staphylokinase (sak)
P508017Sak/Staphylokinase Protein (N-His, Staphylococcus aureus)
P508726Staphylococcus phage entA/SEA Protein (C-His, Staphylococcus phage phiSa2wa-st1930)
JN184012-01Staphylococcus aureus Staphylokinase/sak Recombinant Protein (N-His-SUMO)
GTR19134746-01Recombinant Staphylococcus phage entA/SEA Protein, C-His
MBS156823-01Recombinant Staphylococcus phage vB_SauM_Remus Remus_175 protein, C-His Tag
MBS157366-01Recombinant Staphylococcus phage 44AHJD Tail protein protein, N-His tag
MBS156729-01Recombinant Staphylococcus phage MCE-2014 N-acetylmuramoyl-L-alanine amidase protein, C-His Tag
MBS157363-01Recombinant Staphylococcus phage SLPW Putative major teichoic acid biosynthesis protein C protein, N-His tag
MBS1466137-01Recombinant Staphylococcus aureus Staphylokinase (sak)

Popular Products