Products for Research Use Only
RegisterLogin

I-TAC/CXCL11, Mouse

CAT: 0804-HY-P71886-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71886-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The CXCL11 protein selectively attracts interleukin-activated T cells and induces calcium release in these cells. Its binding to CXCR3 suggests a complex role in T cell chemotaxis and may be important in CNS diseases involving T cell recruitment. I-TAC/CXCL11 Protein, Mouse is the recombinant mouse-derived CXCL11 protein, expressed by E. coli , with tag free.
Product Name Alternative
I-TAC/CXCL11 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Purity
98.00
Smiles
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Molecular Formula
56066 (Gene_ID) Q9JHH5 (F22-M100) (Accession)
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7229-01I-TAC/CXCL11, Human
HY-P7228-01I-TAC/CXCL11, Human (HEK293)
HY-P700233AFAnimal-Free I-TAC/CXCL11, Pig (His)
HY-P700042AF-01Animal-Free I-TAC/CXCL11, Human (His)
HY-180376TAC 363
HY-RS16707Cxcl11 Mouse Pre-designed siRNA Set A
HY-P82024-01CXCL11 Antibody (YA1769, Rabbit)
HY-P10544Humanized anti-tac (HAT) binding peptide
HY-RS23142Cxcl11 Rat Pre-designed siRNA Set A
HY-RS03385CXCL11 Human Pre-designed siRNA Set A

Alternative Products

CatalogName
MBS692031-01Mouse I-TAC (CXCL11)
MBS146535-01Recombinant Mouse I-TAC (CXCL11)
rAP-0183I-TAC (CXCL11) Mouse Recombinant
572-MC-025Recombinant Mouse CXCL11/I-TAC
DY572Mouse CXCL11/I-TAC DuoSet ELISA
572-MC-025/CFRecombinant Mouse CXCL11/I-TAC CF
RP1091M-01Mouse CXCL11 (I-TAC) Recombinant Protein
GTR18695468-01CXCL11/I-TAC Mouse Monoclonal Antibody
E16ME0073Mouse CXCL11/I-TAC ELISA Kit
MBS8427345Mouse I-TAC/CXCL11 ELISA Kit

Popular Products