IL-16, Mouse

• Description :

  IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  IL-16 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Purity :

  95.00

• Smiles :

  SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

• Molecular Formula :

  16170 (Gene_ID) O54824 (S1205-S1322) (Accession)

• Molecular Weight :

  Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins