Products for Research Use Only
RegisterLogin

P2ER3, Human (His)

CAT: 0804-HY-P705619Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P705619Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
P2ER3 Protein, Human (His) is the recombinant human-derived P2ER3, expressed by E.coli , with His abeled tag.
Product Name Alternative
P2ER3 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Smiles
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA
Molecular Formula
5733 (Gene_ID) P43115 (M1-A53) (Accession)
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P703180P2ER3, Human (Sf9, Flag, GFP, His)
HY-P76688UBE2F, Human (His)
HY-P71535-01TEAD4, Human (His)
HY-P76754-01CABP5, Human (His)
HY-P76504-01NAPG, Human (His)
HY-P75930-01MTSS1, Human (His)
HY-P75991-01PSME2, Human (His)
HY-P75691-01CSEN, Human (His)
HY-P72170-01DDX58, Human (His)
HY-P75461-01CALM2, Human (His)

Alternative Products

CatalogName
PT_41578-01Myoglobin His Human Recombinant (Myoglobin His Human)
PT_P10118-01Prolactin Human Recombinant, His Tag (Prolactin Human, His)
PT_75053-01Adiponectin Human Recombinant, His tag (Acrp30 Human, His)
PT_74345-01DnaK Human Recombinant, His Tag (DnaK Human, His)
PT_72828-01Osteoprotegerin Human Recombinant, His Tag (OPG Human, His)
PT_74473-01Cystatin A Human Recombinant, His tag (CSTA Human, His)
PT_74013-01AITRL Human Recombinant, His Tag (AITRL Human, His)
PT_73994-01Glucagon Human Recombinant, His Tag (Glucagon Human, His)
PT_72939-01Nanog Human Recombinant, His Tag (NANOG Human, His)
PT_72839-01Omentin Human Recombinant, His Tag (Omentin Human, His)

Popular Products