Products for Research Use Only

CD151-VLP, Human (HEK293)

CAT: 0804-HY-P704743-01Size: 20 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P704743-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CD151 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
Product Name Alternative
CD151 Protein-VLP, Human (HEK293), Human, HEK293
UNSPSC
12352202
Smiles
GEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY
Molecular Formula
977 (Gene_ID) P48509 (G2-Y253) (Accession)
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins