Prok2, Mouse (His-B2M)

• Description :

  Prok2 Protein, Mouse (His-B2M) is the recombinant mouse-derived Prok2 protein, expressed by E. coli, with N-B2M & N-6*His tag.

• Product Name Alternative :

  Prok2 Protein, Mouse (His-B2M), Mouse, E. coli

• UNSPSC :

  12352202

• Smiles :

  AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK

• Molecular Formula :

  50501 (Gene_ID) Q9QXU7 (A27-K128) (Accession)

• Molecular Weight :

  Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Scientific Category :

  Recombinant Proteins