CCN5, Human (His)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CCN5, Human (His)
Description :
CCN5 Protein, Human (His) is the recombinant human-derived CCN5 protein, expressed by E. coli, with C-10*His tag.Product Name Alternative :
CCN5 Protein, Human (His), Human, E. coliUNSPSC :
12352202Purity :
98.0Smiles :
MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAFMolecular Formula :
8839 (Gene_ID) O76076 (M1-F250) (Accession)Molecular Weight :
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

