IL-4, Human (His)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


IL-4, Human (His)
Description :
IL-4 Protein is an endogenous agonist of IL-4 receptor (IL-4R), which works through the JAK1/JAK3-STAT6 signaling pathway. It can cooperate with SCF to promote the proliferation of human intestinal mast cells (ED50=100 pg/mL) and enhance the release of mediators such as histamine mediated by IgE receptor. IL-4 Protein can inhibit the production of IL-8 by human monocytes and regulate the secretion of endothelial cell factors. It is mainly used for IL-4R targeted therapy research of tumors (such as malignant pleural mesothelioma) and allergic diseases. IL-4 Protein, Human is a recombinant protein of human IL-4, expressed by E. coli, with 6His tag at N-terminal.Product Name Alternative :
IL-4 Protein, Human (His), Human, E. coliUNSPSC :
12352202Purity :
97.00Smiles :
HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSMolecular Formula :
3565 (Gene_ID) P05112-1 (H25-S153) (Accession)Molecular Weight :
Approximately 16 kDaReferences & Citations :
[1]Bischoff SC, et al. IL-4 enhances proliferation and mediator release in mature human mast cells. Proc Natl Acad Sci U S A. 1999 Jul 6;96 (14) :8080-5.|[2]Standiford TJ, et al. IL-4 inhibits the expression of IL-8 from stimulated human monocytes. J Immunol. 1990 Sep 1;145 (5) :1435-9.|[3]Chen C C, et al. TGF-β1, IL-10 and IL-4 differentially modulate the cytokine-induced expression of IL-6 and IL-8 in human endothelial cells. cytokine, 1996, 8 (1) : 58-65.|[4]Ishige K, et al. Potent in vitro and in vivo antitumor activity of interleukin-4-conjugated Pseudomonas exotoxin against human biliary tract carcinoma. Int J Cancer. 2008 Dec 15;123 (12) :2915-22.|[5]Beseth BD, et al. Interleukin-4 receptor cytotoxin as therapy for human malignant pleural mesothelioma xenografts. Ann Thorac Surg. 2004 Aug;78 (2) :436-43; discussion 436-43.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

