Products for Research Use Only
RegisterLogin

PPARD, Human (His)

CAT: 0804-HY-P704244-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P704244-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (His) is the recombinant human-derived PPARD protein, expressed by E. coli, with N-6*His labeled tag.
Product Name Alternative
PPARD Protein, Human (His), Human, E. coli
UNSPSC
12352202
Purity
90.00
Smiles
QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
Molecular Formula
5467 (Gene_ID) Q03181-1 (Q171-Y441) (Accession)
Molecular Weight
Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7S0363PPARD, Human (HEK293, His)
HY-RS10922PPARD Human Pre-designed siRNA Set A
HY-RS10923Ppard Mouse Pre-designed siRNA Set A
HY-RS10924Ppard Rat Pre-designed siRNA Set A
HY-P7999-01PPAR gamma, Human (His)
HY-P7996-01PPAR alpha, Human (His)
HY-P7S1233PPAR alpha, Human (HEK293, His)
HY-P790012-01PPAR-gamma, Human (P37231-2, His)
HY-P700275-01PPAR gamma, Human (C-His, solution)
HY-P702572-01PPAR gamma, Human (P.pastoris, His)

Alternative Products

CatalogName
ARO-P13508-01Recombinant Human PPARD, N-His
P507314PPARD Protein (N-His, Human)
TMPH-03755-01PPARD Protein, Human, Recombinant (His)
GTR19141268-01Recombinant Human PPARD Protein, N-His
PV032302PPARD Protein Vector (Human) (pPB-N-His)
PV032301PPARD Protein Vector (Human) (pPB-C-His)
PV032304PPARD Protein Vector (Human) (pPM-C-His)
CRH3667-01PPARD siRNA (Human)
GTR18886694-01Human PPARD protein
abx929357-01Human PPARD siRNA

Popular Products