KAAG1, Human (His)

CAT: 0804-HY-P704109Size: 1 EachDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P704109Size:1 Each

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

KAAG1 Protein, Human (His) is the recombinant human-derived KAAG1 protein, expressed by E. coli, with C-6*His tag.

Product Name Alternative

KAAG1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK

Molecular Formula

/ (Gene_ID) Q9UBP8 (M1-K84) (Accession)

Molecular Weight

Approximately 15.9 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-RS16470	KAAG1 Human Pre-designed siRNA Set A
HY-P76688	UBE2F, Human (His)
HY-P71535-01	TEAD4, Human (His)
HY-P76754-01	CABP5, Human (His)
HY-P76504-01	NAPG, Human (His)
HY-P75930-01	MTSS1, Human (His)
HY-P75991-01	PSME2, Human (His)
HY-P75691-01	CSEN, Human (His)
HY-P72170-01	DDX58, Human (His)
HY-P75461-01	CALM2, Human (His)

Catalog	Name
TMPH-03988-01	KAAG1 Protein, Human, Recombinant (His)
P505335	KAAG1 Protein (N-GST & C-His, Human)
AR09944PU-N	KAAG1 (1-84, His-tag) Human Protein
TMPH-03989-01	KAAG1 Protein, Human, Recombinant (E. coli, His)
PV088294	KAAG1 Protein Vector (Human) (pPB-C-His)
PV088297	KAAG1 Protein Vector (Human) (pPM-C-His)
PV088295	KAAG1 Protein Vector (Human) (pPB-N-His)
K0002-50	KAAG1, Recombinant, Human, aa1-84, His-Tag (RU2AS)
QP12475-5ug	Recombinant Human KAAG1 Protein, His, E.coli-5ug
E53A02713	KAAG1, 1-84aa, Human, His tag, E.coli