Products for Research Use Only
RegisterLogin

VEGF206, Human (His)

CAT: 0804-HY-P704092Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P704092Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Vascular Endothelial Growth Factor A (VEGF-A) is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF206 Protein, Human (His) is the recombinant human-derived VEGF206 protein, expressed by E. coli, with N-6*His labeled tag.
Product Name Alternative
VEGF206 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Smiles
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular Formula
7422 (Gene_ID) P15692-1 (A27-R232) (Accession)
Molecular Weight
Approximately 30.8 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P78812-01VEGF120, Mouse (Biotinylated, His-Avi)
HY-P76688UBE2F, Human (His)
HY-P71535-01TEAD4, Human (His)
HY-P76754-01CABP5, Human (His)
HY-P76504-01NAPG, Human (His)
HY-P75930-01MTSS1, Human (His)
HY-P75991-01PSME2, Human (His)
HY-P75691-01CSEN, Human (His)
HY-P72170-01DDX58, Human (His)
HY-P75461-01CALM2, Human (His)

Alternative Products

CatalogName
MBS691733-01Human VEGF206
E109765Human VEGF206 ELISA Kit
OKCD04191-96WVEGF206 ELISA Kit (Human)
OKCD04191VEGF206 ELISA Kit (Human) (OKCD04191)
MBS8806435-01Human VEGF206 (Vascular Endothelial Growth Factor 206) ELISA Kit
MBS2707330-01Human Vascular Endothelial Growth Factor 206 (VEGF206) ELISA Kit
abx496256-01Human Vascular Endothelial Growth Factor 206 (VEGF206) CLIA Kit
KBH22815GENLISA™ Human Vascular Endothelial Growth Factor 206 (VEGF206) ELISA
366689Vascular Endothelial Growth Factor 206 (VEGF206) BioAssayTM ELISA Kit (Human)
PT_41578-01Myoglobin His Human Recombinant (Myoglobin His Human)

Popular Products