Products for Research Use Only

Vitronectin, Human (417a.a)

CAT: 0804-HY-P704067Size: 1 EachDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P704067Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Vitronectin is a multifunctional cell adhesion factor in serum and tissues that interacts with glycosaminoglycans and proteoglycans. It acts as an adhesion molecule between cells and the matrix, binding to specific integrins. Vitronectin Protein, Human (417a.a) is the recombinant human-derived Vitronectin protein, expressed by E. coli, with tag free.
Product Name Alternative
Vitronectin Protein, Human (417a.a), Human, E. coli
UNSPSC
12352202
Smiles
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Molecular Formula
7448 (Gene_ID) P04004/AAH05046.1 (V62-L478) (Accession)
Molecular Weight
Approximately 46-58 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice
Scientific Category
Recombinant Proteins