Vitronectin, Human (417a.a)

• Description:

  Vitronectin is a multifunctional cell adhesion factor in serum and tissues that interacts with glycosaminoglycans and proteoglycans. It acts as an adhesion molecule between cells and the matrix, binding to specific integrins. Vitronectin Protein, Human (417a.a) is the recombinant human-derived Vitronectin protein, expressed by E. coli, with tag free.

• Product Name Alternative:

  Vitronectin Protein, Human (417a.a), Human, E. coli

• UNSPSC:

  12352202

• Smiles:

  DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

• Molecular Formula:

  7448 (Gene_ID) P04004/AAH05046.1 (V62-L478) (Accession)

• Molecular Weight:

  Approximately 46-58 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions:

  Dry ice

• Scientific Category:

  Recombinant Proteins