SFTPC, Human (GST)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


SFTPC, Human (GST)
Description :
SFTPC Protein, Human (GST) is the recombinant human-derived SFTPC protein, expressed by E. coli, with N-GST tag.Product Name Alternative :
SFTPC Protein, Human (GST), Human, E. coliUNSPSC :
12352202Smiles :
FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLMolecular Formula :
6440 (Gene_ID) P11686-1 (F24-L58) (Accession)Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Scientific Category :
Recombinant Proteins

