Products for Research Use Only
RegisterLogin

MAPK1/ERK2, Human (Inactive, GST)

CAT: 0804-HY-P704008-01Size: 10 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P704008-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (Inactive, GST) is the recombinant human-derived MAPK1/ERK2 protein, expressed by E. coli, with N-GST labeled tag.
Product Name Alternative
MAPK1/ERK2 Protein, Human (Inactive, GST), Human, E. coli
UNSPSC
12352202
Smiles
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Molecular Formula
5594 (Gene_ID) P28482-1 (M1-S360) (Accession)
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P75223-01MAPK1/ERK2, Human (sf9, His)
HY-P702735-01MAPK1/ERK2, Human (Active, Flag-His)
HY-P702941-01CDK8, Human (Inactive, sf9, GST)
HY-P703020-01JNK1, Mouse (Inactive, GST)
HY-P703400STK32A, Human (Inactive, sf9, His, GST)
HY-P703638TSSK3, Human (Inactive, sf9, His, GST)
HY-P703167-01MYLK, Human (Inactive, sf9, His, GST)
HY-P703603STK17B, Human (Inactive, sf9, His, GST)
HY-P703386GRK7, Human (Inactive, sf9, His, GST)
HY-P703578PDK3, Human (Inactive, sf9, His, GST)

Alternative Products

CatalogName
BITP1402-01Recombinant Human ERK2/MAPK1 Inactive Enzyme
22060314-1Human ERK2/MAPK1 Inactive Enzyme (Recombinant)
RP-673Recombinant (E.Coli) Human ERK2/MAPK1 Inactive Enzyme
P514997ERK2/MAPK1/MAPK2 Protein (N-GST, Human)
047118ERK2/MAPK1/MAPK2, Recombinant, Human, GST-Tag discontinued
PKSH031927Recombinant Human ERK2/MAPK1/MAPK2 Protein (GST Tag)
MBS2546577-01Recombinant Human ERK2 / MAPK1 / MAPK2 Protein (GST tag)
GWB-912000ERK2 inactive Human Recombinant Protein
40056Human/Mouse ERK2 (K52R), Inactive, His-tag
P526621MAPK1 Protein (N-GST, Human)

Popular Products