Products for Research Use Only

MAPK1/ERK2, Human (Inactive, GST)

CAT: 0804-HY-P704008-01Size: 10 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P704008-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (Inactive, GST) is the recombinant human-derived MAPK1/ERK2 protein, expressed by E. coli, with N-GST labeled tag.
Product Name Alternative
MAPK1/ERK2 Protein, Human (Inactive, GST), Human, E. coli
UNSPSC
12352202
Smiles
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Molecular Formula
5594 (Gene_ID) P28482-1 (M1-S360) (Accession)
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins