Products for Research Use Only
RegisterLogin

STEAP1, Mouse (Cell-Free, His)

CAT: 0804-HY-P702448Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P702448Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The STEAP1 protein is classified as a member of the metal reductase family and cannot function as a functional metal reductase, mainly due to the lack of binding sites for the electron-donating substrate NADPH. This unique feature distinguishes STEAP1 from typical metal reductases, which are characterized by their ability to catalyze the reduction of metal ions using NADPH as an electron donor. STEAP1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived STEAP1 protein, expressed by E. coli Cell-free , with C-10*His labeled tag.
Product Name Alternative
STEAP1 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free
UNSPSC
12352202
Smiles
MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSHLQHAVHVDAFDCPSELQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQYFYKIPILVINKVLPMVAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAVYSLSYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVSQFVWYMPPTFMIAVFLPTLVLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL
Molecular Formula
70358 (Gene_ID) Q9CWR7 (M1-L339) (Accession)
Molecular Weight
40.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P705541S1pr2, Mouse (Cell-Free, His)
HY-P705481CH25H, Mouse (Cell-Free, His)
HY-P702352-01KDELR2, Mouse (Cell-Free, His)
HY-P702442-01SLC30A8, Mouse (Cell-Free, His)
HY-P702216-01AQP4, Mouse (Cell-Free, His)
HY-P7S1176MARCH9, Mouse (Cell-Free, His)
HY-P705449Sting1, Mouse (Cell-Free, His)
HY-P7S1473Gpr27, Mouse (Cell-Free, His)
HY-P705539Kdelr3, Mouse (Cell-Free, His)
HY-P702232CCR1, Mouse (Cell-Free, His)

Alternative Products

CatalogName
TMPH-04340-01STEAP1 Protein, Mouse, Recombinant (His)
PV234662STEAP1 Protein Vector (Mouse) (pPB-C-His)
PV234663STEAP1 Protein Vector (Mouse) (pPB-N-His)
PV234665STEAP1 Protein Vector (Mouse) (pPM-C-His)
TMPH-02536-01BNIP3 Protein, Mouse, Recombinant (Cell-Free, His)
PR02942Recombinant Mouse STEAP1 Protein, N-Flag & C-His
MV409012-01Mouse STEAP1 Recombinant Protein (N-GST & C-His)
MBS9719748-01Mouse CXCL16 Protein, His tag (Animal-Free)
PRP1142-01Mouse EGF protein, His tag (Animal-Free)
PRP1181-01Mouse CXCL11 Protein, His tag (Animal-Free)

Popular Products