Recombinant Tityus bahiensis Toxin Tb2-II

CAT:
399-CSB-BP350784TEQ-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Tityus bahiensis Toxin Tb2-II - image 1

Recombinant Tityus bahiensis Toxin Tb2-II

  • Product Name Alternative:

    P-Mice-Ins-beta* NaTx5.4
  • Abbreviation:

    Recombinant Tityus bahiensis Toxin Tb2-II protein
  • UniProt:

    P60276
  • Expression Region:

    1-62aa
  • Organism:

    Tityus bahiensis (Brazilian scorpion)
  • Target Sequence:

    KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    Baculovirus
  • Field of Research:

    Others
  • Relevance:

    Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing . This toxin is active against both mammals and insects.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    10.8 kDa
  • References & Citations:

    "Purification, amino-acid sequence and partial characterization of two toxins with anti-insect activity from the venom of the South American scorpion Tityus bahiensis (Buthidae) ." Pimenta A.M.C., Martin-Eauclaire M.-F., Rochat H., Figueiredo S.G., Kalapothakis E., Afonso L.C.C., De Lima M.E. Toxicon 39:1009-1019 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length