Recombinant Mouse Complement C4-B (C4b), partial
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Mouse Complement C4-B (C4b), partial
Description:
Recombinant Mouse Complement C4-B (C4b), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Complement C4-B (C4b) . Accession Number: P01029; C4b. Expression Region: 1448-1738aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 39.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.Short Description:
Recombinant Mouse Complement C4-B (C4b), partial is a purified Recombinant Protein.Accession Number:
P01029; C4bExpression Region:
1448-1738aaHost:
E. coliTarget:
Complement C4-B (C4b)Conjugation:
UnconjugatedTag:
N-Terminal 6xHis-TaggedField of Research:
ImmunologyEndotoxin:
Not TestedPurity:
>90% by SDS-PAGEActivity:
Not TestedLength:
PartialReconstitution:
Refer to the datasheet/CoA included in the product pouch.Molecular Weight:
39.0kDaShipping Conditions:
Ice packsStorage Conditions:
-20°C. Avoid repeated freeze/thaw cycles.Species:
Mouse (Mus musculus)Protein Name:
Recombinant ProteinAA Sequence:
EAPKVVEEQESRVQYTVCIWRNGKLGLSGMAIADITLLSGFHALRADLEKLTSLSDRYVSHFETDGPHVLLYFDSVPTTRECVGFGASQEVVVGLVQPSSAVLYDYYSPDHKCSVFYAAPTKSQLLATLCSGDVCQCAEGKCPRLLRSLERRVEDKDGYRMRFACYYPRVEYGFTVKVLREDGRAAFRLFESKITQVLHFRKDTMASIGQTRNFLSRASCRLRLEPNKEYLIMGMDGETSDNKGDPQYLLDSNTWIEEMPSEQMCKSTRHRAACFQLKDFLMEFSSRGCQV
