Recombinant Mouse Complement C4-B (C4b), partial

CAT:
617-RPC30981-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Complement C4-B (C4b), partial - image 1

Recombinant Mouse Complement C4-B (C4b), partial

  • Description :

    Recombinant Mouse Complement C4-B (C4b), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Complement C4-B (C4b) . Accession Number: P01029; C4b. Expression Region: 1448-1738aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 39.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.
  • Short Description :

    Recombinant Mouse Complement C4-B (C4b), partial is a purified Recombinant Protein.
  • Accession Number :

    P01029; C4b
  • Expression Region :

    1448-1738aa
  • Host :

    E. coli
  • Target :

    Complement C4-B (C4b)
  • Conjugation :

    Unconjugated
  • Tag :

    N-Terminal 6xHis-Tagged
  • Field of Research :

    Immunology
  • Endotoxin :

    Not Tested
  • Purity :

    >90% by SDS-PAGE
  • Activity :

    Not Tested
  • Length :

    Partial
  • Reconstitution :

    Refer to the datasheet/CoA included in the product pouch.
  • Molecular Weight :

    39.0kDa
  • Shipping Conditions :

    Ice packs
  • Storage Conditions :

    -20°C. Avoid repeated freeze/thaw cycles.
  • Species :

    Mouse (Mus musculus)
  • Protein Name :

    Recombinant Protein
  • AA Sequence :

    EAPKVVEEQESRVQYTVCIWRNGKLGLSGMAIADITLLSGFHALRADLEKLTSLSDRYVSHFETDGPHVLLYFDSVPTTRECVGFGASQEVVVGLVQPSSAVLYDYYSPDHKCSVFYAAPTKSQLLATLCSGDVCQCAEGKCPRLLRSLERRVEDKDGYRMRFACYYPRVEYGFTVKVLREDGRAAFRLFESKITQVLHFRKDTMASIGQTRNFLSRASCRLRLEPNKEYLIMGMDGETSDNKGDPQYLLDSNTWIEEMPSEQMCKSTRHRAACFQLKDFLMEFSSRGCQV

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide