Recombinant Mouse Complement receptor type 2 (Cr2), partial
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Mouse Complement receptor type 2 (Cr2), partial
Description :
Recombinant Mouse Complement receptor type 2 (Cr2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Complement receptor type 2 (Cr2) . Accession Number: P19070; Cr2. Expression Region: 12-145aa. Tag Info: N-terminal 6xHis-Myc-tagged. Theoretical MW: 18.7kda. Target Synonyms: Complement C3d receptor CD_antigen: CD21 Restrictions: For Research Use Only. Not for use in diagnostic procedures.Short Description :
Recombinant Mouse Complement receptor type 2 (Cr2), partial is a purified Recombinant Protein.Accession Number :
P19070; Cr2Expression Region :
12-145aaHost :
Mammalian CellsTarget :
Complement receptor type 2 (Cr2)Conjugation :
UnconjugatedTag :
N-Terminal 6xHis-Myc-TaggedField of Research :
ImmunologyEndotoxin :
Not TestedPurity :
>90% by SDS-PAGEActivity :
Not TestedLength :
PartialReconstitution :
Refer to the datasheet/CoA included in the product pouch.Molecular Weight :
18.7kDaShipping Conditions :
Ice packsStorage Conditions :
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name :
Complement C3d receptor CD_antigen: CD21Species :
Mouse (Mus musculus)Protein Name :
Recombinant ProteinAA Sequence :
ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE

