Recombinant Human G patch domain-containing protein 4 (GPATCH4), partial

CAT:
617-RPC30217-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human G patch domain-containing protein 4 (GPATCH4), partial - image 1

Recombinant Human G patch domain-containing protein 4 (GPATCH4), partial

  • Description:

    Recombinant Human G patch domain-containing protein 4 (GPATCH4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: G patch domain-containing protein 4 (GPATCH4) . Accession Number: Q5T3I0; GPATCH4. Expression Region: 1-190aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 28.6kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.
  • Short Description:

    Recombinant Human G patch domain-containing protein 4 (GPATCH4), partial is a purified Recombinant Protein.
  • Accession Number:

    Q5T3I0; GPATCH4
  • Expression Region:

    1-190aa
  • Host:

    E. coli
  • Target:

    G patch domain-containing protein 4 (GPATCH4)
  • Conjugation:

    Unconjugated
  • Tag:

    N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
  • Field of Research:

    Others
  • Endotoxin:

    Not Tested
  • Purity:

    >90% by SDS-PAGE
  • Activity:

    Not Tested
  • Length:

    Partial
  • Reconstitution:

    Refer to the datasheet/CoA included in the product pouch.
  • Molecular Weight:

    28.6kDa
  • Shipping Conditions:

    Ice packs
  • Storage Conditions:

    -20°C. Avoid repeated freeze/thaw cycles.
  • Species:

    Human (Homo sapiens)
  • Protein Name:

    Recombinant Protein
  • AA Sequence:

    MNVTPEVKSRGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRYNHPKPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQAFLARLKGQDP