Recombinant Human G patch domain-containing protein 4 (GPATCH4), partial
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Human G patch domain-containing protein 4 (GPATCH4), partial
Description:
Recombinant Human G patch domain-containing protein 4 (GPATCH4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: G patch domain-containing protein 4 (GPATCH4) . Accession Number: Q5T3I0; GPATCH4. Expression Region: 1-190aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 28.6kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.Short Description:
Recombinant Human G patch domain-containing protein 4 (GPATCH4), partial is a purified Recombinant Protein.Accession Number:
Q5T3I0; GPATCH4Expression Region:
1-190aaHost:
E. coliTarget:
G patch domain-containing protein 4 (GPATCH4)Conjugation:
UnconjugatedTag:
N-Terminal 10xHis-Tagged and C-Terminal Myc-TaggedField of Research:
OthersEndotoxin:
Not TestedPurity:
>90% by SDS-PAGEActivity:
Not TestedLength:
PartialReconstitution:
Refer to the datasheet/CoA included in the product pouch.Molecular Weight:
28.6kDaShipping Conditions:
Ice packsStorage Conditions:
-20°C. Avoid repeated freeze/thaw cycles.Species:
Human (Homo sapiens)Protein Name:
Recombinant ProteinAA Sequence:
MNVTPEVKSRGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRYNHPKPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQAFLARLKGQDP
