Recombinant Mouse STEAP1 protein (Steap1)

• Description:

  Recombinant Mouse STEAP1 protein (Steap1) is a purified CF Transmembrane Protein. Purity: >90% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: STEAP1 protein (Steap1) . Accession Number: Q9CWR7; Steap1. Expression Region: 1-339aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 40.7kda. Target Synonyms: Six-transmembrane epithelial antigen of prostate 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Mouse STEAP1 protein (Steap1) is a purified CF Transmembrane Protein.

• Accession Number:

  Q9CWR7; Steap1

• Expression Region:

  1-339aa

• Host:

  E. coli

• Target:

  STEAP1 protein (Steap1)

• Conjugation:

  Unconjugated

• Tag:

  C-Terminal 10xHis-Tagged

• Field of Research:

  Epigenetics, Nuclear Signaling

• Endotoxin:

  Not Tested

• Purity:

  >90% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Full Length

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  40.7kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Six-transmembrane epithelial antigen of prostate 1

• Species:

  Mouse (Mus musculus)

• Protein Name:

  CF Transmembrane Protein

• AA Sequence:

  MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSHLQHAVHVDAFDCPSELQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQYFYKIPILVINKVLPMVAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAVYSLSYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVSQFVWYMPPTFMIAVFLPTLVLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL