Recombinant E. coli Outer membrane protein A (ompA)

• Description :

  Recombinant E. coli Outer membrane protein A (ompA) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: Outer membrane protein A (ompA) . Accession Number: P0A910; ompA. Expression Region: 22-346aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 38.0kda. Target Synonyms: Outer membrane protein II; con; tolG; tut Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description :

  Recombinant E. coli Outer membrane protein A (ompA) is a purified CF Transmembrane Protein.

• Accession Number :

  P0A910; ompA

• Expression Region :

  22-346aa

• Host :

  E. coli

• Target :

  Outer membrane protein A (ompA)

• Conjugation :

  Unconjugated

• Tag :

  N-Terminal 10xHis-Tagged

• Field of Research :

  Metabolism

• Endotoxin :

  Not Tested

• Purity :

  >85% by SDS-PAGE

• Activity :

  Not Tested

• Length :

  Full Length of Mature Protein

• Reconstitution :

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight :

  38.0kDa

• Shipping Conditions :

  Ice packs

• Storage Conditions :

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name :

  Outer membrane protein II; con; tolG; tut

• Species :

  E. coli (strain K12)

• Protein Name :

  CF Transmembrane Protein

• AA Sequence :

  APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA