Recombinant E. coli Outer membrane protein A (ompA)

• Description:

  Recombinant E. coli Outer membrane protein A (ompA) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: Outer membrane protein A (ompA) . Accession Number: P0A910; ompA. Expression Region: 22-346aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 38.0kda. Target Synonyms: Outer membrane protein II; con; tolG; tut Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant E. coli Outer membrane protein A (ompA) is a purified CF Transmembrane Protein.

• Accession Number:

  P0A910; ompA

• Expression Region:

  22-346aa

• Host:

  E. coli

• Target:

  Outer membrane protein A (ompA)

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal 10xHis-Tagged

• Field of Research:

  Metabolism

• Endotoxin:

  Not Tested

• Purity:

  >85% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Full Length of Mature Protein

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  38.0kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Outer membrane protein II; con; tolG; tut

• Species:

  E. coli (strain K12)

• Protein Name:

  CF Transmembrane Protein

• AA Sequence:

  APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA