Recombinant Staphylococcus aureus Sortase A (srtA), partial

• Description:

  Recombinant Staphylococcus aureus Sortase A (srtA), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain NCTC 8325) . Target Name: Sortase A (srtA) . Accession Number: Q2FV99; srtA. Expression Region: 25-206aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 24.9kda. Target Synonyms: Surface protein sorting A Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Staphylococcus aureus Sortase A (srtA), partial is a purified Recombinant Protein.

• Accession Number:

  Q2FV99; srtA

• Expression Region:

  25-206aa

• Host:

  E. coli

• Target:

  Sortase A (srtA)

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal 6xHis-Tagged

• Field of Research:

  Microbiology

• Endotoxin:

  Not Tested

• Purity:

  >85% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Partial

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  24.9kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Surface protein sorting A

• Species:

  Staphylococcus aureus (strain NCTC 8325)

• Protein Name:

  Recombinant Protein

• AA Sequence:

  AKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK