Recombinant Mouse Apolipoprotein E (Apoe)

CAT:
617-RPC29837-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Apolipoprotein E (Apoe) - image 1

Recombinant Mouse Apolipoprotein E (Apoe)

  • Description:

    Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Apolipoprotein E (Apoe) . Accession Number: P08226; Apoe. Expression Region: 19-311aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 39kda. Target Synonyms: Apo-E Restrictions: For Research Use Only. Not for use in diagnostic procedures.
  • Short Description:

    Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein.
  • Accession Number:

    P08226; Apoe
  • Expression Region:

    19-311aa
  • Host:

    Mammalian Cells
  • Target:

    Apolipoprotein E (Apoe)
  • Conjugation:

    Unconjugated
  • Tag:

    N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
  • Field of Research:

    Cardiovascular
  • Endotoxin:

    Not Tested
  • Purity:

    >85% by SDS-PAGE
  • Activity:

    Not Tested
  • Length:

    Full Length of Mature Protein
  • Reconstitution:

    Refer to the datasheet/CoA included in the product pouch.
  • Molecular Weight:

    39kDa
  • Shipping Conditions:

    Ice packs
  • Storage Conditions:

    -20°C. Avoid repeated freeze/thaw cycles.
  • Target Alternative Name:

    Apo-E
  • Species:

    Mouse (Mus musculus)
  • Protein Name:

    Recombinant Protein
  • AA Sequence:

    EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ