Recombinant Mouse Apolipoprotein E (Apoe)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Mouse Apolipoprotein E (Apoe)
Description:
Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Apolipoprotein E (Apoe) . Accession Number: P08226; Apoe. Expression Region: 19-311aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 39kda. Target Synonyms: Apo-E Restrictions: For Research Use Only. Not for use in diagnostic procedures.Short Description:
Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein.Accession Number:
P08226; ApoeExpression Region:
19-311aaHost:
Mammalian CellsTarget:
Apolipoprotein E (Apoe)Conjugation:
UnconjugatedTag:
N-Terminal 10xHis-Tagged and C-Terminal Myc-TaggedField of Research:
CardiovascularEndotoxin:
Not TestedPurity:
>85% by SDS-PAGEActivity:
Not TestedLength:
Full Length of Mature ProteinReconstitution:
Refer to the datasheet/CoA included in the product pouch.Molecular Weight:
39kDaShipping Conditions:
Ice packsStorage Conditions:
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name:
Apo-ESpecies:
Mouse (Mus musculus)Protein Name:
Recombinant ProteinAA Sequence:
EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
