Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5)

• Description:

  Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Immunoglobulin lambda-like polypeptide 5 (IGLL5) . Accession Number: B9A064; IGLL5. Expression Region: 36-214aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 21.3kda. Target Synonyms: G lambda-1 Germline immunoglobulin lambda 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) is a purified Recombinant Protein.

• Accession Number:

  B9A064; IGLL5

• Expression Region:

  36-214aa

• Host:

  Yeast

• Target:

  Immunoglobulin lambda-like polypeptide 5 (IGLL5)

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal 6xHis-Tagged

• Field of Research:

  Immunology

• Endotoxin:

  Not Tested

• Purity:

  >90% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Full Length of Mature Protein

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  21.3kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  G lambda-1 Germline immunoglobulin lambda 1

• Species:

  Human (Homo sapiens)

• Protein Name:

  Recombinant Protein

• AA Sequence:

  HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS